Glixx Laboratories Inc

               Your exclusive source for bioactive molecules

Glixx Laboratories

 

   sales@glixxlabs.com      Toll-Free: (855)Go-Glixx   Tel: 781-333-5348    Fax: 781-333-5368 
hIAPP

 

CAS: 122384-88-7

 

Chemical Name: Human islet amyloid polypeptide; Amylin; Diabetes Associated Peptide Amide human; KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2, disulfide bridge 2-7; H-Lys-Cys(1)-Asn-Thr-Ala-Thr-Cys(1)-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Ala-Ile-Leu-Ser-Ser-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2

 

 
GLXC-21907For Lab R&D Uses Only
        Cat No: GLXC-21907

 

Purity:               >98% (HPLC)

Storage:             Refrigerator (4 °C)

 

 

Product Description:

Human islet amyloid polypeptide, being associated with development of type-II diabetes mellitus (T2DM)

 

Analytical data click for PDF file

 

 

Place an order!

Price & Availability





POA
 








Bulk inquiry contact:
sales@glixxlabs.com
service@glixxlabs.com